Anti-SMO (Smoothened Homolog, Protein Gx, SMOH)

Anti-SMO (Smoothened Homolog, Protein Gx, SMOH)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
133575.100 100 µg - -

3 - 19 Werktage*

850,00 €
 
G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce... mehr
Produktinformationen "Anti-SMO (Smoothened Homolog, Protein Gx, SMOH)"
G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7 and GLI3 in the cilia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF*, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 133575

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 1D9
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Full length recombinant corresponding to aa653-787 from human SMO (NP_005622) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SMO (Smoothened Homolog, Protein Gx, SMOH)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen