Anti-SKP2

Anti-SKP2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4170 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The F box protein Skp2 (S-phase... mehr
Produktinformationen "Anti-SKP2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The F box protein Skp2 (S-phase kinase-associated protein 2) is oncogenic, and its frequent amplification and overexpression correlate with the grade of malignancy of certain tumors. Skp2 controls p300-p53 signaling pathways in cancer cells, making it a potential molecular target for cancer therapy. This gene positively regulates the G(1)-S transition by controlling the stability of several G(1) regulators, such as the cell cycle inhibitor p27. This study provides evidence of a role for an F-box protein in oncogenesis and establishes SKP2 as a protooncogene causally involved in the pathogenesis of lymphomas.
Schlagworte: Anti-SKP2, Anti-FBXL1, Anti-p45skp2, Anti-F-box protein Skp2, Anti-F-box/LRR-repeat protein 1, Anti-S-phase kinase-associated protein 2, Anti-Cyclin-A/CDK2-associated protein p45, SKP2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4170

Eigenschaften

Anwendung: WB, IHC (paraffin), IF
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL were used as the immunogen for the SKP2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SKP2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen