Anti-RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70(S6K)-al

Anti-RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70(S6K)-al
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
251295.100 100 µg - -

3 - 19 Werktage*

715,00 €
 
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases.... mehr
Produktinformationen "Anti-RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70(S6K)-al"
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq, Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 251295

Eigenschaften

Anwendung: ELISA, IF, WB
Antikörper-Typ: Monoclonal
Klon: 4H4
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: RPS6KB1 (NP_003152, 416aa-525aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70(S6K)-al"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen