Anti-REG1 alpha

Anti-REG1 alpha
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41304.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Might act as an inhibitor of spontaneous calcium carbonate precipitation. May... mehr
Produktinformationen "Anti-REG1 alpha"
Protein function: Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration. [The UniProt Consortium]
Schlagworte: Anti-PTP, Anti-PSP, Anti-REG, Anti-PSPS, Anti-ICRF, Anti-REG1A, Anti-REG-1-alpha, Anti-Lithostathine-1-alpha, Anti-Pancreatic stone protein, Anti-Pancreatic thread protein, Anti-Regenerating protein I alpha, Anti-Islet cells regeneration factor
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41304

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide located within the following region: SLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
MW: 19 kD
Format: Affinity Purified

Datenbank Information

UniProt ID : P05451 | Passende Produkte
Gene ID : GeneID 5967 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-REG1 alpha"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen