Anti-NQO1

Anti-NQO1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31977 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene is a member of the NAD(P)H... mehr
Produktinformationen "Anti-NQO1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized. Protein function: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. [The UniProt Consortium]
Schlagworte: Anti-QR1, Anti-DTD, Anti-NQO1, Anti-DIA4, EC=1.6.5.2, Anti-Azoreductase, Anti-DT-diaphorase, Anti-Quinone reductase 1, Anti-Menadione reductase, Anti-Phylloquinone reductase, Anti-NAD(P)H:quinone oxidoreductase 1, Anti-NAD(P)H dehydrogenase [quinone] 1, N
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31977

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK of human NQO1 were used as the immunogen for the NQO1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NQO1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen