Anti-MPP1

Anti-MPP1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59030.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Essential regulator of neutrophil polarity. Regulates neutrophil polarization... mehr
Produktinformationen "Anti-MPP1"
Protein function: Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity. [The UniProt Consortium]
Schlagworte: Anti-p55, Anti-MPP1, Anti-DXS552E, Anti-Membrane protein, palmitoylated 1, Anti-55 kDa erythrocyte membrane protein
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59030

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to aa. 409-450 of Human MPP1 (TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF)
MW: 52 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MPP1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen