Anti-MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Memb

Anti-MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Memb
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
129343.100 100 µg - -

3 - 19 Werktage*

715,00 €
 
This gene encodes a protein which is a member of family 38 of the glycosyl hydrolases. The... mehr
Produktinformationen "Anti-MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Memb"
This gene encodes a protein which is a member of family 38 of the glycosyl hydrolases. The protein is located in the Golgi and catalyzes the final hydrolytic step in the asparagine-linked oligosaccharide (N-glycan) maturation pathway. Mutations in the mouse homolog of this gene have been shown to cause a systemic autoimmune disease similar to human systemic lupus erythematosus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCRFSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQLR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: Anti-MANA2, Anti-Man II, Anti-MAN2A1, Anti-AMan II, EC=3.2.1.114, Anti-Alpha-mannosidase 2, Anti-Golgi alpha-mannosidase II, Anti-Mannosidase alpha class 2A member 1, Anti-Mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
Hersteller: United States Biological
Hersteller-Nr: 129343

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 1G9
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa1045-1144 from human MAN2A1 (NP_002363) with GST tag. MW of the GST tag alone is 26kD.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MAN2A1 (MANA2, Alpha-mannosidase 2, Golgi alpha-mannosidase II, Mannosidase alpha Class 2A Memb"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen