Anti-Kininogen 1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40932.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: (1) Kininogens are inhibitors of thiol proteases, (2) HMW-kininogen plays an... mehr
Produktinformationen "Anti-Kininogen 1"
Protein function: (1) Kininogens are inhibitors of thiol proteases, (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII, (3) HMW-kininogen inhibits the thrombin- and plasmin- induced aggregation of thrombocytes, (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action), (5) LMW-kininogen inhibits the aggregation of thrombocytes, (6) LMW- kininogen is in contrast to HMW-kininogen not involved in blood clotting. [The UniProt Consortium]
Schlagworte: Anti-Kng, Anti-Kng1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40932

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse
Immunogen: Synthetic peptide corresponding to aa. 227-259 of Mouse Kininogen 1. (ECRGNLFMDINNKIANFSQSCTLYSGDDLVEAL)
MW: 73 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Kininogen 1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen