Anti-KIF3B

Anti-KIF3B
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41257.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome... mehr
Produktinformationen "Anti-KIF3B"
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
Schlagworte: Anti-KIF3B, Anti-KIAA0359
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41257

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide around the C-terminal region of Human KIF3B. (within the following region: SGGGGEEEEEEGEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEE)
MW: 82 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-KIF3B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen