- Suchergebnis für K20196
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K20196" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG41257.50
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Schlagworte: | Anti-KIF3B, Anti-KIAA0359 |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
584,00 €
Artikelnummer: ATA-HPA066525.100
Polyclonal Antibody against Human KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Validated applications: ICC, WB, Uniprot ID: O15066, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in tethering...
| Schlagworte: | Anti-KIF3B, Anti-KIAA0359 |
| Anwendung: | ICC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA066525.25
Polyclonal Antibody against Human KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Validated applications: ICC, WB, Uniprot ID: O15066, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Involved in tethering...
| Schlagworte: | Anti-KIF3B, Anti-KIAA0359 |
| Anwendung: | ICC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: 037442.200
The protein encoded by this gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved...
| Schlagworte: | Anti-KIF3B, Anti-KIAA0359 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ELK-ES19917.100
Protein function: Microtubule-based molecular motor that transport intracellular cargos, such as vesicles, organelles and protein complexes. Uses ATP hydrolysis to generate force to bind and move along the microtubule. Plays a role in cilia formation (PubMed:32386558). Involved in photoreceptor integrity and opsin...
| Schlagworte: | Anti-KIF3B, Anti-KIAA0359, KIF3B rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: ABS-PP-6366.100
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Schlagworte: | Kinesin-like protein KIF3B, HH0048, Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95781.100
PrEST Antigen KIF3B, Gene description: kinesin family member 3B, Alternative Gene Names: FLA8, KIAA0359, KLP-11, Antigen sequence: GEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKMRLLKEKEKKM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in tethering the chromosomes to...
| Schlagworte: | KIF3B, KIAA0359 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: CSB-PA343231XA01DLU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-KLP5, Anti-Klp68D, Anti-CG7293, Anti-Kinesin-like protein Klp68D, Klp68D Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Drosophila melanogaster (Fruit fly) |
ab 1.529,00 €
Artikelnummer: ABS-PP-6366-L.100
Protein function: Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Microtubule-based anterograde translocator for membranous organelles. Plus end-directed microtubule sliding activity in vitro. [The UniProt Consortium]
| Schlagworte: | Kinesin-like protein KIF3B, HH0048, Microtubule plus end-directed kinesin motor 3B) [Cleaved into: Kinesin-like protein... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19.5 kD |
ab 115,00 €