Anti-Keratocan

Anti-Keratocan
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59334.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: May be important in developing and maintaining corneal transparency and for the... mehr
Produktinformationen "Anti-Keratocan"
Protein function: May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix. [The UniProt Consortium]
Schlagworte: Anti-KTN, Anti-KERA, Anti-SLRR2B, Anti-Keratocan, Anti-Keratan sulfate proteoglycan keratocan
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59334

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse (Erwartet: bovine)
Immunogen: Synthetic peptide corresponding to aa. 77-109 of Human Keratocan. (YLQNNLIETIPEKPFENATQLRWINLNKNKITN)
MW: 41 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Keratocan"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen