Anti-Keratocan

Anti-Keratocan
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31830 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Keratocan (KTN), also known as keratan... mehr
Produktinformationen "Anti-Keratocan"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea. Protein function: May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix. [The UniProt Consortium]
Schlagworte: Anti-KTN, Anti-KERA, Anti-SLRR2B, Anti-Keratocan, Anti-Keratan sulfate proteoglycan keratocan, Keratocan Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31830

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Keratocan"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen