Anti-GRK2

Anti-GRK2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59543.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Specifically phosphorylates the agonist-occupied form of the beta-adrenergic... mehr
Produktinformationen "Anti-GRK2"
Protein function: Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner (PubMed:19306925, PubMed:19715378). Positively regulates ciliary smoothened (SMO)- dependent Hedgehog (Hh) signaling pathway by faciltating the trafficking of SMO into the cilium and the stimulation of SMO activity. [The UniProt Consortium]
Schlagworte: Anti-ADRBK1, Anti-Beta-ARK-1, Anti-Beta-adrenergic receptor kinase 1, Anti-G-protein coupled receptor kinase 2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59543

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat (Erwartet: human)
Immunogen: Synthetic peptide corresponding to a sequence of Human GRK2. (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK)
MW: 79 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GRK2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen