Anti-GATA2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41643.50 50 µl - -

6 - 14 Werktage*

551,00 €
 
Protein function: Transcriptional activator which regulates endothelin-1 gene expression in... mehr
Produktinformationen "Anti-GATA2"
Protein function: Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. [The UniProt Consortium]
Schlagworte: Anti-GATA2, Anti-GATA-binding protein 2, Anti-Endothelial transcription factor GATA-2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41643

Eigenschaften

Anwendung: ChIP, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse (Erwartet: cow, rat, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human GATA2. (within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA)
MW: 505 kD
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GATA2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen