Anti-GABARAPL1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41411.50 50 µl - -

6 - 14 Werktage*

551,00 €
 
Protein function: Ubiquitin-like modifier that increases cell-surface expression of kappa-type... mehr
Produktinformationen "Anti-GABARAPL1"
Protein function: Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed:16431922, PubMed:20404487). Through its interaction with the reticulophagy receptor TEX264, paticipates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538, PubMed:31006537). [The UniProt Consortium]
Schlagworte: Anti-GEC1, Anti-GEC-1, Anti-GABARAPL1, Anti-Early estrogen-regulated protein, Anti-Glandular epithelial cell protein 1, Anti-GABA(A) receptor-associated protein-like 1, Anti-Gamma-aminobutyric acid receptor-associated protein-like 1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41411

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human GABARAPL1. (within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL)
MW: 14 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-GABARAPL1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen