Anti-FUT1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31996 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galactoside 2-alpha-L-fucosyltransferase 1... mehr
Produktinformationen "Anti-FUT1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. Protein function: Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values. [The UniProt Consortium]
Schlagworte: Anti-H, Anti-FUT1, EC=2.4.1.69, Anti-Alpha(1,2)FT 1, Anti-Fucosyltransferase 1, Anti-Blood group H alpha 2-fucosyltransferase, Anti-Galactoside 2-alpha-L-fucosyltransferase 1, Anti-GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1, FUT1 Antib
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31996

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EVDSRTPWRELQLHDWMSEEYADLRDPFLKL of human FUT1 were used as the immunogen for the FUT1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FUT1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen