Anti-FMO3

Anti-FMO3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58711.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Essential hepatic enzyme that catalyzes the oxygenation of a wide variety of... mehr
Produktinformationen "Anti-FMO3"
Protein function: Essential hepatic enzyme that catalyzes the oxygenation of a wide variety of nitrogen- and sulfur-containing compounds including drugs as well as dietary compounds (PubMed:10759686, PubMed:30381441). Plays an important role in the metabolism of trimethylamine (TMA), via the production of trimethylamine N-oxide (TMAO) metabolite (PubMed:9776311). TMA is generated by the action of gut microbiota using dietary precursors such as choline, choline containing compounds, betaine or L-carnitine. By regulating TMAO concentration, FMO3 directly impacts both platelet responsiveness and rate of thrombus formation (PubMed:29981269). [The UniProt Consortium]
Schlagworte: Anti-FMO3, Anti-FMO 3, Anti-FMO II, Anti-FMO form 2, EC=1.14.13.148, Anti-Dimethylaniline oxidase 3, Anti-Trimethylamine monooxygenase, Anti-Hepatic flavin-containing monooxygenase 3, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 3
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58711

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 404-433 of Human FMO3 (DMMNDINEKMEKKRKWFGKSETIQTDYIVY)
MW: 60 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FMO3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen