Anti-FMO3

Anti-FMO3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32065 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FMO3 (Flavin-containing Monooxygenase 3)... mehr
Produktinformationen "Anti-FMO3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide. Protein function: Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds (PubMed:9224773). [The UniProt Consortium]
Schlagworte: Anti-FMO3, Anti-FMO 3, Anti-FMO II, Anti-FMO form 2, EC=1.14.13.8, EC=1.14.13.148, Anti-Dimethylaniline oxidase 3, Anti-Trimethylamine monooxygenase, Anti-Hepatic flavin-containing monooxygenase 3, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 3, F
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32065

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids DMMNDINEKMEKKRKWFGKSETIQTDYIVY of human FMO3 were used as the immunogen for the FMO3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FMO3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen