Anti-FLT3 Ligand

Anti-FLT3 Ligand
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58709.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Stimulates the proliferation of early hematopoietic cells by activating FLT3.... mehr
Produktinformationen "Anti-FLT3 Ligand"
Protein function: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. [The UniProt Consortium]
Schlagworte: Anti-Flt3L, Anti-FLT3LG, Anti-Flt3 ligand, Anti-SL cytokine, Anti-Fms-related tyrosine kinase 3 ligand
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58709

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Synthetic peptide corresponding to aa. 79-110 of Human Flt3 Ligand (AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK)
MW: 26 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FLT3 Ligand"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen