Anti-Flt3 ligand

Anti-Flt3 ligand
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32117 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FLT3LG (FMS-Related Tyrosine Kinase 3... mehr
Produktinformationen "Anti-Flt3 ligand"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FLT3LG (FMS-Related Tyrosine Kinase 3 Ligand) also called FLT3 LIGAND, FL or FLT3L, is a protein which in humans is encoded by the FLT3LG gene. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8-positive classical DCs and their CD103-positive tissue counterparts. Flt3 ligand (FL) is a hematopoietic four helical bundlecytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors. Lyman et al. (1993) found that Flt3 ligand stimulated proliferation of hematopoietic progenitor cells isolated from mouse fetal liver or adult mouse bone marrow. Hannum et al. (1994) concluded that FL enhances the response of stem and primitive progenitor cells to other growth factors to generate all myeloid lineages except erythroid cells. Assays of C-terminally truncated FL proteins confirmed that the N-terminal half conferred FL activity. Depletion of the Pi3k -Mtor negative regulator Pten facilitated Flt3l-driven DC development in culture. Protein function: Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. [The UniProt Consortium]
Schlagworte: Anti-Flt3L, Anti-FLT3LG, Anti-SL cytokine, Anti-Flt3 ligand, Anti-Fms-related tyrosine kinase 3 ligand, Flt3 ligand Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32117

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK of human Flt3 ligand were used as the immunogen for the Flt3 ligand antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Flt3 ligand"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen