Anti-FDCSP

Anti-FDCSP
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32777 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FDC-SP or follicular dendritic... mehr
Produktinformationen "Anti-FDCSP"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion. Protein function: Can bind to the surface of B-lymphoma cells, but not T- lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells. [The UniProt Consortium]
Schlagworte: Anti-FDCSP, Anti-FDC-SP, Anti-C4orf7, Anti-FDC secreted protein, Anti-Follicular dendritic cell secreted peptide, FDCSP Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32777

Eigenschaften

Anwendung: IHC (paraffin), IF
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids 18-51 (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FDCSP"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen