Anti-FDCSP

Anti-FDCSP
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59445.50 50 µg - -

10 - 15 Werktage*

551,00 €
 
Protein function: Can bind to the surface of B-lymphoma cells, but not T- lymphoma cells,... mehr
Produktinformationen "Anti-FDCSP"
Protein function: Can bind to the surface of B-lymphoma cells, but not T- lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells. [The UniProt Consortium]
Schlagworte: Anti-FDCSP, Anti-C4orf7, Anti-FDC-SP, Anti-FDC secreted protein, Anti-Follicular dendritic cell secreted peptide
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59445

Eigenschaften

Anwendung: IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide corresponding to aa. 18-51 of Human FDCSP. (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR)
MW: 10 kD
Format: Antigen Affinity Purified

Datenbank Information

UniProt ID : Q8NFU4 | Passende Produkte
Gene ID : GeneID 260436 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FDCSP"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen