Anti-FBXL11

Anti-FBXL11
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59309.50 50 µg - -

6 - 14 Werktage*

551,00 €
 
Protein function: Histone demethylase that specifically demethylates 'Lys- 36' of histone H3,... mehr
Produktinformationen "Anti-FBXL11"
Protein function: Histone demethylase that specifically demethylates 'Lys- 36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys- 36'. May also recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Required to maintain the heterochromatic state. Associates with centromeres and represses transcription of small non-coding RNAs that are encoded by the clusters of satellite repeats at the centromere. Required to sustain centromeric integrity and genomic stability, particularly during mitosis. Regulates circadian gene expression by repressing the transcriptional activator activity of CLOCK- ARNTL/BMAL1 heterodimer and RORA in a catalytically-independent manner (PubMed:26037310). [The UniProt Consortium]
Schlagworte: Anti-KDM2A, Anti-CXXC8, Anti-F-box protein FBL7, Anti-F-box protein Lilina, Anti-F-box/LRR-repeat protein 11, Anti-Lysine-specific demethylase 2A, Anti-CXXC-type zinc finger protein 8, Anti-[Histone-H3]-lysine-36 demethylase 1A
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59309

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse (Erwartet: rat)
Immunogen: Synthetic peptide corresponding to a sequence of Human FBXL11. (KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR)
MW: 133 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-FBXL11"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen