Anti-DHRS9

Anti-DHRS9
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41272.50 50 µl - -

10 - 15 Werktage*

584,00 €
 
Protein function: 3-alpha-hydroxysteroid dehydrogenase that converts 3-... mehr
Produktinformationen "Anti-DHRS9"
Protein function: 3-alpha-hydroxysteroid dehydrogenase that converts 3- alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone (PubMed:11294878, PubMed:29541409). Plays also a role in the biosynthesis of retinoic acid from retinaldehyde (PubMed:11304534, PubMed:12618084). Can utilize both NADH and NADPH. [The UniProt Consortium]
Schlagworte: Anti-RDHL, Anti-DHRS9, Anti-RDH15, Anti-RDH-E2, Anti-RDH-TBE, Anti-3-alpha-HSD, Anti-Retinol dehydrogenase 15, Anti-3-alpha hydroxysteroid dehydrogenase, Anti-Dehydrogenase/reductase SDR family member 9, Anti-Short-chain dehydrogenase/reductase retSDR8
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41272

Eigenschaften

Anwendung: IP, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: human, mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human DHRS9. (within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV)
MW: 35 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-DHRS9"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen