Anti-DHODH, clone 4E3.

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ6591 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dihydroorotate dehydrogenase (DHODH) is an... mehr
Produktinformationen "Anti-DHODH, clone 4E3."
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Protein function: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. Required for UMP biosynthesis via de novo pathway. [The UniProt Consortium]
Schlagworte: Anti-DHODH, Anti-DHOdehase, Anti-Dihydroorotate oxidase, Anti-Dihydroorotate dehydrogenase (quinone), mitochondrial, DHODH Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ6591

Eigenschaften

Anwendung: WB, IF, FC
Antikörper-Typ: Monoclonal
Klon: 4E3.
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human, mouse, rat
Immunogen: N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-DHODH, clone 4E3."
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen