Anti-Cystatin SN

Anti-Cystatin SN
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58548.50 50 µl - -

6 - 14 Werktage*

584,00 €
 
Protein function: Human saliva appears to contain several cysteine proteinase inhibitors that are... mehr
Produktinformationen "Anti-Cystatin SN"
Protein function: Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well. [The UniProt Consortium]
Schlagworte: Anti-CST1, Anti-Cystatin-1, Anti-Cystatin-SN, Anti-Cystain-SA-I, Anti-Salivary cystatin-SA-1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58548

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide around the Middle region of Human Cystatin SN. (within the following sequence: AISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPN)
MW: 15 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Cystatin SN"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen