Anti-CST1 (Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1)

Anti-CST1 (Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
125417.50 50 µg - -

3 - 19 Werktage*

699,00 €
 
Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically... mehr
Produktinformationen "Anti-CST1 (Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1)"
Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 125417

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Full length human CST1, aa1-141 (NP_001889.2).
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CST1 (Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen