Anti-CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced

Anti-CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
C8297-98W.100 100 µg - -

3 - 19 Werktage*

715,00 €
 
CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant, and plays a role in the growth,... mehr
Produktinformationen "Anti-CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced"
CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant, and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumor growth inhibition and angiogenesis. Studies have shown that CXCL9 is active against E.coli, S.aureus, L. monocytogenes and S.pyogenes. Applications: Suitable for use in ELISA. Other applications have not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT , Storage and Stability:, May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: Anti-HuMIG, Anti-C-X-C motif chemokine 9, Anti-Small-inducible cytokine B9, Anti-Gamma-interferon-induced monokine, Anti-Monokine induced by interferon-gamma
Hersteller: United States Biological
Hersteller-Nr: C8297-98W

Eigenschaften

Anwendung: ELISA
Antikörper-Typ: Monoclonal
Klon: 1F5
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: CXCL9 (AAH63122, 23-126aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen