Anti-CAT (Catalase, MGC138422, MGC138424)

Anti-CAT (Catalase, MGC138422, MGC138424)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
124371.100 100 µg - -

3 - 19 Werktage*

715,00 €
 
Catalase is known marker for peroxisomes. It is the most abundant protein in the peroxisomes. It... mehr
Produktinformationen "Anti-CAT (Catalase, MGC138422, MGC138424)"
Catalase is known marker for peroxisomes. It is the most abundant protein in the peroxisomes. It is present in all aerobically respiring organisms. It protects cells form the toxicity of hydrogen peroxide. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 124371

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 2G6
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Partial recombinant corresponding to aa1-100 from human CAT (NP_001743) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-CAT (Catalase, MGC138422, MGC138424)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen