Anti-Butyrylcholinesterase

Anti-Butyrylcholinesterase
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41412.50 50 µl - -

6 - 14 Werktage*

551,00 €
 
Protein function: Esterase with broad substrate specificity. Contributes to the inactivation of... mehr
Produktinformationen "Anti-Butyrylcholinesterase"
Protein function: Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters. [The UniProt Consortium]
Schlagworte: Anti-CHE1, Anti-BCHE, EC=3.1.1.8, Anti-Cholinesterase, Anti-Choline esterase II, Anti-Pseudocholinesterase, Anti-Butyrylcholine esterase, Anti-Acylcholine acylhydrolase
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41412

Eigenschaften

Anwendung: IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit, sheep)
Immunogen: Synthetic peptide around the N-terminal region of Human Butyrylcholinesterase. (within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ)
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Butyrylcholinesterase"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen