Anti-BMP2

Anti-BMP2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31949 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. BMP2 is also known as Bone morphogenetic... mehr
Produktinformationen "Anti-BMP2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily.BMP-2, like otherbone morphogenetic proteins,plays an important role in the development of bone and cartilage. It is involved in thehedgehog pathway,TGF beta signaling pathway, and incytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model. Protein function: Induces cartilage and bone formation (PubMed:3201241). Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4 (PubMed:24362451). [The UniProt Consortium]
Schlagworte: Anti-BMP2, Anti-BMP-2, Anti-BMP2A, Anti-BMP-2A, Anti-Bone morphogenetic protein 2, Anti-Bone morphogenetic protein 2A, BMP2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31949

Eigenschaften

Anwendung: WB, IHC (paraffin), ELISA
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-BMP2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen