Anti-ATP2A3

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R30157 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sarcoplasmic/endoplasmic reticulum calcium... mehr
Produktinformationen "Anti-ATP2A3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. WhatÆs more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Protein function: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. [The UniProt Consortium]
Schlagworte: Anti-ATP2A3, Anti-SERCA3, EC=3.6.3.8, Anti-Calcium pump 3, Anti-SR Ca(2+)-ATPase 3, Anti-Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, ATP2A3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R30157

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: An amino acid sequence from the N-terminus of human ATP2A3 (MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) was used as the immunogen for this ATP2A3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ATP2A3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen