Anti-ATP2A1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R30155 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SERCA1, also called ATP2A1, is an enzyme... mehr
Produktinformationen "Anti-ATP2A1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Protein function: Key regulator of striated muscle performance by acting as the major Ca(2+) ATPase responsible for the reuptake of cytosolic Ca(2+) into the sarcoplasmic reticulum. Catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. [The UniProt Consortium]
Schlagworte: Anti-ATP2A1, Anti-SERCA1, EC=3.6.3.8, Anti-Calcium pump 1, Anti-SR Ca(2+)-ATPase 1, Anti-Endoplasmic reticulum class 1/2 Ca(2+) ATPase, Anti-Sarcoplasmic/endoplasmic reticulum calcium ATPase 1, Anti-Calcium-transporting ATPase sarcoplasmic reticulum type,
Hersteller: NSJ Bioreagents
Hersteller-Nr: R30155

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ATP2A1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen