Anti-ARID1A

Anti-ARID1A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59223.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Involved in transcriptional activation and repression of select genes by... mehr
Produktinformationen "Anti-ARID1A"
Protein function: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. [The UniProt Consortium]
Schlagworte: Anti-hELD, Anti-B120, Anti-hOSA1, Anti-BAF250, Anti-ARID1A, Anti-BAF250A, Anti-Osa homolog 1, Anti-SWI-like protein, Anti-BRG1-associated factor 250, Anti-BRG1-associated factor 250a, Anti-SWI/SNF complex protein p270
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59223

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: hamster)
Immunogen: Synthetic peptide corresponding to aa. 1021-1053 of Human ARID1A. (KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR)
MW: 242 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ARID1A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen