Anti-ARID1A

Anti-ARID1A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31797 100 µg - -

7 - 12 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. AT-rich interactive domain-containing... mehr
Produktinformationen "Anti-ARID1A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.
Schlagworte: Anti-hELD, Anti-B120, Anti-hOSA1, Anti-BAF250, Anti-ARID1A, Anti-BAF250A, Anti-Osa homolog 1, Anti-SWI-like protein, Anti-BRG1-associated factor 250, Anti-BRG1-associated factor 250a, Anti-SWI/SNF complex protein p270, ARID1A Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31797

Eigenschaften

Anwendung: WB, IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR of human ARID1A were used as the immunogen for the ARID1A antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ARID1A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen