Anti-ARC / Activity-regulated cytoskeleton-associated protein

Anti-ARC / Activity-regulated cytoskeleton-associated protein
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32271 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Arc is widely considered to be an... mehr
Produktinformationen "Anti-ARC / Activity-regulated cytoskeleton-associated protein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience. Protein function: Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. [The UniProt Consortium]
Schlagworte: Anti-Arg3.1, Anti-ARC/ARG3.1, Anti-Activity-regulated gene 3.1 protein homolog, Anti-Activity-regulated cytoskeleton-associated protein, ARC Antibody / Activity-regulated cytoskeleton-associated protein
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32271

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ARC / Activity-regulated cytoskeleton-associated protein"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen