Anti-AKR1D1, clone 6I4

Anti-AKR1D1, clone 6I4
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ5641 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human delta(4)-3-oxosteroid... mehr
Produktinformationen "Anti-AKR1D1, clone 6I4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet. Protein function: Catalyzes the stereospecific NADPH-dependent reduction of the C4-C5 double bond of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure to yield an A/B cis-ring junction. This cis-configuration is crucial for bile acid biosynthesis and plays important roles in steroid metabolism. Capable of reducing a broad range of delta-(4)-3-ketosteroids from C18 (such as, 17beta- hydroxyestr-4-en-3-one) to C27 (such as, 7alpha-hydroxycholest-4-en-3- one). [The UniProt Consortium]
Schlagworte: Anti-SRD5B1, Anti-AKR1D1, Anti-3-oxo-5-beta-steroid 4-dehydrogenase, Anti-Delta(4)-3-oxosteroid 5-beta-reductase, Anti-Aldo-keto reductase family 1 member D1, Anti-Delta(4)-3-ketosteroid 5-beta-reductase, AKR1D1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ5641

Eigenschaften

Anwendung: WB, IHC (paraffin), FC
Antikörper-Typ: Monoclonal
Klon: 6I4
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-AKR1D1, clone 6I4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen