Anti-ADRA1A

Anti-ADRA1A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32076 100 µg - -

3 - 10 Werktage*

790,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ADRA1A, also known as alpha-1A adrenergic... mehr
Produktinformationen "Anti-ADRA1A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle. Protein function: This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes. [The UniProt Consortium]
Schlagworte: Anti-ADRA1A, Anti-ADRA1C, Anti-Alpha-1A adrenoceptor, Anti-Alpha-1A adrenoreceptor, Anti-Alpha-1A adrenergic receptor, Anti-Alpha-1C adrenergic receptor, Anti-Alpha-adrenergic receptor 1c, ADRA1A Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32076

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ADRA1A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen