IL-6 protein(N-His)(active) (recombinant swine)

IL-6 protein(N-His)(active) (recombinant swine)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
E-PKSS000005.20 20 µg -

7 - 16 Werktage*

533,00 €
 
Activity: Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED50 for this... mehr
Produktinformationen "IL-6 protein(N-His)(active) (recombinant swine)"
Activity: Measure by its ability to induce proliferation in T1165.85.2.1 cells. The ED50 for this effect is <1.5 ng/mL. Sequence: MNSLSTSAFSPVAFSLGLLLVMATAFPTPERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM. Fusion tag: N-His Endotoxin: Please contact us for more information. Protein function: Protein function: Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway. The interaction with the membrane- bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. [The UniProt Consortium]
Schlagworte: IL6, IL-6, Interleukin-6, Recombinant Swine IL-6 protein(N-His)(active)
Hersteller: Elabscience
Hersteller-Nr: E-PKSS000005

Eigenschaften

Anwendung: Active, Cell culture
Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: swine
MW: 24.78 kD
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -80°C
Versand: 4°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "IL-6 protein(N-His)(active) (recombinant swine)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen