IL-38 protein(N-His) (recombinant mouse)

IL-38 protein(N-His) (recombinant mouse)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
E-PKSM041483.20 20 µg -

7 - 16 Werktage*

289,00 €
E-PKSM041483.100 100 µg -

7 - 16 Werktage*

791,00 €
 
Sequence:... mehr
Produktinformationen "IL-38 protein(N-His) (recombinant mouse)"
Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T- cells in response to heat-killed Candida albicans. Reduces IL36G- induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2. [The UniProt Consortium]
Schlagworte: Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse IL-38 protein(N-His)
Hersteller: Elabscience
Hersteller-Nr: E-PKSM041483

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: mouse
MW: 17.9 kD
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -80°C
Versand: 4°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "IL-38 protein(N-His) (recombinant mouse)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen