CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)

CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
E-PKSM041515.20 20 µg -

7 - 16 Werktage*

241,00 €
E-PKSM041515.100 100 µg -

7 - 16 Werktage*

632,00 €
 
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The... mehr
Produktinformationen "CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)"
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <1 µg/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function:
Schlagworte: Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys, Recombinant Mouse CXCL7 (40-113) protein(N-His)(active)
Hersteller: Elabscience
Hersteller-Nr: E-PKSM041515

Eigenschaften

Anwendung: Active, cell culture
Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: mouse
MW: 13.08 kD
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -80°C
Versand: +4°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen