Zu "Q9EQI5" wurden 16 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
CXCL7 Protein, Mouse, Recombinant (aa 40-113, His)
CXCL7 Protein, Mouse, Recombinant (aa 40-113, His)

Artikelnummer: TGM-TMPY-00218-50ug

Description: CXCL7 Protein, Mouse, Recombinant (aa 40-113, His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 10.4 kDa and the accession number is Q9EQI5.
Schlagworte: b-TG1, NAP-2, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), MDGF, LA-PF4, Cxcl7, NAP-2-L1, CTAPIII, TGB,...
MW: 10.4 kD
505,00 €
Bewerten
Recombinant Mouse CXCL7 Protein(Trx Tag)
Recombinant Mouse CXCL7 Protein(Trx Tag)

Artikelnummer: E-PDEM100165.1

Pro-platelet basic protein (PPBP) is also known as Chemokine (C-X-C motif) ligand 7 (CXCL7) and nucleosome assembly protein (Nap-2). Nap-2 / PPBP / CXCL7 is released in large amounts from platelets following their activation and is a platelet-derived growth factor that belongs to the CXC chemokine family. This...
Schlagworte: Ppbp, Recombinant Mouse CXCL7 Protein(Trx Tag)
ab 192,00 €
Bewerten
NEU
CXCL7 Protein, Mouse, Recombinant (aa 40-113, His)
CXCL7 Protein, Mouse, Recombinant (aa 40-113, His)

Artikelnummer: TGM-TMPY-00218-10ug

Description: CXCL7 Protein, Mouse, Recombinant (aa 40-113, His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 10.4 kDa and the accession number is Q9EQI5.
Schlagworte: b-TG1 , pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) , NAP-2 , Cxcl7 , CTAPIII , NAP-2-L1 , MDGF , LA-PF4...
MW: 10.4 kD
ab 82,00 €
Bewerten
Mouse BetaTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) Superset Max DIY ELISA
Mouse BetaTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta)...

Artikelnummer: G-AEES05197.480

Mouse BetaTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) Superset Max DIY ELISA
Schlagworte: Ppbp
Anwendung: ELISA
Spezies-Reaktivität: mouse
919,00 €
Bewerten
CXCL7, mouse recombinant (rmoCXCL7)
CXCL7, mouse recombinant (rmoCXCL7)

Artikelnummer: RP1935M-005

Produced in Yeast. Amino acid sequence: KSDGMDPYIE LRCRCTNTIS GIPFNSISLV NVYRPGVHCA DVEVIATLKN GQKTCLDPNA PGVKRIVMKI LEGY (74).
Schlagworte: Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys
Anwendung: Bioassays
Exprimiert in: Yeast
Ursprungsart: mouse
MW: 8.1 kD
ab 233,00 €
Bewerten
-10 %
Rabattaktion
QuicKey Pro Mouse CXCL7 (Thromboglobulin, Beta) ELISA Kit
QuicKey Pro Mouse CXCL7 (Thromboglobulin, Beta) ELISA Kit

Artikelnummer: E-OSEL-M0022.24

PPBP, slso named as NAP2, or beta-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis,...
Schlagworte: Thymus chemokine 1, Platelet basic protein, Chemokine subfamily B Cys-X-Cys
Anwendung: ELISA
Spezies-Reaktivität: mouse
122,00 € ab 109,80 €
Bewerten
Anti-NAP-2 / CXCL7 / PPBP
Anti-NAP-2 / CXCL7 / PPBP

Artikelnummer: NSJ-RQ4113

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Chemokine (C-X-C motif) ligand 7 (CXCL7), also known as NAP2 or Pro-Platelet basic protein (PPBP), is a human gene. The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent...
Schlagworte: Anti-Thymus chemokine 1, Anti-Platelet basic protein, Anti-Pro-platelet basic protein, Anti-Chemokine subfamily B...
Anwendung: WB, IHC (paraffin), ELISA
Wirt: Rabbit
Spezies-Reaktivität: mouse
790,00 €
Bewerten
Beta-Thromboglobulin (bTG) BioAssay(TM) ELISA Kit (Mouse)
Beta-Thromboglobulin (bTG) BioAssay(TM) ELISA Kit (Mouse)

Artikelnummer: 023697.96

Beta-Thromboglobulin (bTG) BioAssay(TM) ELISA Kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of bTG in mouse serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Detection Range: 1.56-100pg/ml, Sensitivity: 0.69pg/ml, Intra-Assay CV: <10%,...
Schlagworte: Protein Ppbp, Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys,...
Anwendung: ELISA
Spezies-Reaktivität: mouse
1.048,00 €
Bewerten
Beta-Thromboglobulin (bTG) Recombinant, Mouse
Beta-Thromboglobulin (bTG) Recombinant, Mouse

Artikelnummer: 153671.10

Source:, Recombinant Mouse from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q9EQI5, Fragment: Lys40~Tyr113 (Accession No: Q9EQI5), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-K SDGMDPYIEL RCRCTNTISG IPFNSISLVN VYRPGVHCAD VEVIATLKNG QKTCLDPNAP GVKRIVMKIL EGY,...
ab 454,00 €
Bewerten
CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)
CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)

Artikelnummer: E-PKSM041515.100

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <1 µg/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by...
Schlagworte: Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys, Recombinant Mouse...
Anwendung: Active, cell culture
Exprimiert in: E.coli
Ursprungsart: mouse
MW: 13.08 kD
ab 241,00 €
Bewerten
CXCL7 (48-109) protein(N-His)(active) (recombinant mouse)
CXCL7 (48-109) protein(N-His)(active) (recombinant mouse)

Artikelnummer: E-PKSM041516.100

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by...
Schlagworte: Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys, Recombinant Mouse...
Anwendung: Active, cell culture
Exprimiert in: E.coli
Ursprungsart: mouse
MW: 13.08 kD
ab 241,00 €
Bewerten
-10 %
Rabattaktion
Uncoated Mouse betaTG/PBP/CXCL7/NAP2(Thromboglobulin, Beta) ELISA Kit
Uncoated Mouse betaTG/PBP/CXCL7/NAP2(Thromboglobulin,...

Artikelnummer: E-UNEL-M0083.15

Colormetric. Detection Range: 31.25-2000 pg/mL.
Schlagworte: Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys
Anwendung: ELISA
Spezies-Reaktivität: mouse
485,00 € ab 436,50 €
Bewerten
1 von 2 Seiten