Histone Deacetylase 8, Recombinant, Human (HDAC8)

Histone Deacetylase 8, Recombinant, Human (HDAC8)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
H5109-53C.50 50 µg - -

3 - 19 Werktage*

1.177,00 €
 
Recombinant protein corresponding to full length human HDAC8 with a C-terminal His-tag expressed... mehr
Produktinformationen "Histone Deacetylase 8, Recombinant, Human (HDAC8)"
Recombinant protein corresponding to full length human HDAC8 with a C-terminal His-tag expressed in baculovirus in Sf21 insect cells (NM_018486). Specific Activity: ~290pmol/min/ug , Assay Conditions: , 25mM Tris-HCl, pH 8.0, 137mM sodium chloride, 2.7mM KCl, 1mM MgCl2, 0.05% Tween 20 and 20uM HDAC class 2a substrate. Incubation condition: 30 minutes at 37ºC, followed by incubating with developer at RT for 20 minutes. Fluorescence intensity is measured at exc360/em460. Amino Acid Sequence: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQM RIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEG IFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLG ILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVS DVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTI AGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVIL GKTLSSEIPDHEFFT A YGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVVH HHHHH, Applications: Useful for the study of enzyme kinetics, screening inhibitors and selectivity profiling. Other applications not tested. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: HD8, HDAC8, CDA07, EC=3.5.1.98, Histone deacetylase 8
Hersteller: United States Biological
Hersteller-Nr: H5109-53C

Eigenschaften

Konjugat: No
Format: Purified

Handhabung & Sicherheit

Lagerung: -80°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Histone Deacetylase 8, Recombinant, Human (HDAC8)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen