Carbonic Anhydrase IX (CA9) Recombinant, Human

Carbonic Anhydrase IX (CA9) Recombinant, Human
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
153817.10 10 µg - -

3 - 19 Werktage*

448,00 €
153817.50 50 µg - -

3 - 19 Werktage*

675,00 €
153817.200 200 µg - -

3 - 19 Werktage*

1.038,00 €
 
Source:|Recombinant Human from E. coli||Purity:|>95%||Endotoxin:|1.0EU per 1ug (determined by the... mehr
Produktinformationen "Carbonic Anhydrase IX (CA9) Recombinant, Human"
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: Q8N6T7, Fragment: Pro59~Asp414 (Accession No: Q8N6T7), Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFELRRQ-PL GEEDLPSEED SPREEDPPGE EDLPGEEDLP GEEDLPEVKP KSEEEGSLKL EDLPTVEAPG DPQEPQNNAH RDKEGDDQSH WRYGGDPPWP RVSPACAGRF QSPVDIRPQL AAFCPALRPL ELLGFQLPPL PELRLRNNGH SVQLTLPPGL EMALGPGREY RALQLHLHWG AAGRPGSEHT VEGHRFPAEI HVVHLSTAFA RVDEALGRPG GLAVLAAFLE EGPEENSAYE QLLSRLEEIA EEGSETQVPG LDISALLPSD FSRYFQYEGS LTTPPCAQGV IWTVFNQTVM LSAKQLHTLS DTLWGPGDSR LQLNFRATQP LNGRVIEASF PAGVDSSPRA AEPVQLNSCL AAGD, Epitope Tag: N-terminal Tags: His-tag and T7-tag, Molecular Weight: 43.3kD, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE., Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Hersteller: United States Biological
Hersteller-Nr: 153817

Eigenschaften

Konjugat: No
Format: Highly Purified

Datenbank Information

UniProt ID : Q8N6T7 | Passende Produkte

Handhabung & Sicherheit

Lagerung: vT
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Carbonic Anhydrase IX (CA9) Recombinant, Human"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen