Brain Natriuretic Peptide, Cyclic, Human, aa1-32 (BNP, Natriuretic Peptide B, Gamma-Brain Natriureti

Brain Natriuretic Peptide, Cyclic, Human, aa1-32 (BNP, Natriuretic Peptide B, Gamma-Brain Natriureti
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
298131.100 100 µg - -

3 - 19 Werktage*

477,00 €
298131.1 1 mg - -

3 - 19 Werktage*

1.071,00 €
 
Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a... mehr
Produktinformationen "Brain Natriuretic Peptide, Cyclic, Human, aa1-32 (BNP, Natriuretic Peptide B, Gamma-Brain Natriureti"
Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3, Source: Synthetic human BNP, AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: NPPB
Hersteller: United States Biological
Hersteller-Nr: 298131

Eigenschaften

Konjugat: No
MW: 3,5
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Brain Natriuretic Peptide, Cyclic, Human, aa1-32 (BNP, Natriuretic Peptide B, Gamma-Brain Natriureti"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen