Anti-YES1 (v-yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1, HsT441, P61-YES, Yes, c-yes)

Anti-YES1 (v-yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1, HsT441, P61-YES, Yes, c-yes)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
253511.50 50 µg - -

3 - 19 Werktage*

850,00 €
 
This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein... mehr
Produktinformationen "Anti-YES1 (v-yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1, HsT441, P61-YES, Yes, c-yes)"
This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. [provided by RefSeq, Applications: Suitable for use in ELISA, Western Blot, In situ Proximity Ligation Assay (Cell). Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 253511

Eigenschaften

Anwendung: ELISA, WB
Antikörper-Typ: Monoclonal
Klon: 3C6
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: YES1 (AAH48960, 1aa-80aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-YES1 (v-yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1, HsT441, P61-YES, Yes, c-yes)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen