Anti-YEATS4 (YEATS Domain Containing 4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9)

Anti-YEATS4 (YEATS Domain Containing 4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
135479.50 50 µg - -

3 - 19 Werktage*

850,00 €
 
Applications:|Suitable for use in Immunofluorescence and Western Blot. Other applications not... mehr
Produktinformationen "Anti-YEATS4 (YEATS Domain Containing 4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9)"
Applications:, Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI*, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 135479

Eigenschaften

Anwendung: IF, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Full length human YEATS4, aa1-228 (AAH00994).
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-YEATS4 (YEATS Domain Containing 4, 4930573H17Rik, B230215M10Rik, GAS41, NUBI-1, YAF9)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen