Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
| Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
|---|---|---|---|---|---|---|---|
| NSJ-R32317 | 100 µg | - | - |
3 - 10 Werktage* |
790,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Serine/threonine-protein kinase VRK1 is an... mehr
Produktinformationen "Anti-VRK1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Serine/threonine-protein kinase VRK1 is an enzyme that in humans is encoded by the VRK1 gene. This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. It is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN. Protein function: Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr- 18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity. [The UniProt Consortium]
| Schlagworte: | Anti-VRK1, EC=2.7.11.1, Anti-Vaccinia-related kinase 1, Anti-Serine/threonine-protein kinase VRK1, VRK1 Antibody |
| Hersteller: | NSJ Bioreagents |
| Hersteller-Nr: | R32317 |
Eigenschaften
| Anwendung: | WB |
| Antikörper-Typ: | Polyclonal |
| Konjugat: | No |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
| Immunogen: | Amino acids EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK of human VRK1 were used as the immunogen for the VRK1 antibody. |
| Format: | Purified |
Datenbank Information
| KEGG ID : | K08816 | Passende Produkte |
| UniProt ID : | Q99986 | Passende Produkte |
| Gene ID : | GeneID 7443 | Passende Produkte |
Handhabung & Sicherheit
| Lagerung: | -20°C |
| Versand: | -20°C (International: -20°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-VRK1"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen