Anti-VPS4B

Anti-VPS4B
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41263.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: Involved in late steps of the endosomal multivesicular bodies (MVB) pathway.... mehr
Produktinformationen "Anti-VPS4B"
Protein function: Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses). VPS4A/B are required for the exosomal release of SDCBP, CD63 and syndecan (PubMed:22660413). [The UniProt Consortium]
Schlagworte: Anti-SKD1, Anti-MIG1, Anti-VPS4B, EC=3.6.4.6, Anti-Protein SKD1, Anti-Cell migration-inducing gene 1 protein, Anti-Suppressor of K(+) transport growth defect 1, Anti-Vacuolar protein sorting-associated protein 4B
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41263

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: cow, rat, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide located within the following region: EKLKEYLKNKEKKAQKPVKEGQPSPADEKGNDSDGEGESDDPEKKKLQNQ
MW: 49 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-VPS4B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen