Anti-UHRF1

Anti-UHRF1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32309 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ubiquitin-like, containing PHD and RING... mehr
Produktinformationen "Anti-UHRF1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ubiquitin-like, containing PHD and RING finger domains, 1 is a protein which in humans is encoded by the UHRF1 gene. This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12. Protein function: Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, also plays a key role in chromatin modification: through its tudor-like regions and PHD- type zinc fingers, specifically recognizes and binds histone H3 trimethylated at 'Lys-9' (H3K9me3) and unmethylated at 'Arg-2' (H3R2me0), respectively, and recruits chromatin proteins. Enriched in pericentric heterochromatin where it recruits different chromatin modifiers required for this chromatin replication. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins such as histone H3 and PML. It is still unclear how E3 ubiquitin-protein ligase activity is related to its role in chromatin in vivo. May be involved in DNA repair. [The UniProt Consortium]
Schlagworte: Anti-hNp95, Anti-UHRF1, Anti-hUHRF1, Anti-HuNp95, Anti-ICBP90, EC=6.3.2.-, Anti-Nuclear protein 95, Anti-RING finger protein 106, Anti-Transcription factor ICBP90, Anti-Nuclear zinc finger protein Np95, Anti-E3 ubiquitin-protein ligase UHRF1, UHRF1 Antibo
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32309

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ of human UHRF1 were used as the immunogen for the UHRF1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-UHRF1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen